If you have been reading about PPARδ agonist and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-05-18. Where a claim depends on a specific study, the study is described rather than over-claimed.
In laboratory settings, cardarine is studied as a tool compound for probing PPARδ biology. Published experiments often use cell cultures, rodent models, or isolated tissues. Some investigations focus on metabolic effects, while others assess potential risks such as carcinogenicity observed in long-term animal studies. Because human trials are sparse, most knowledge comes from preclinical work and adverse event reports. Scientific literature frequently notes the gap between animal findings and human outcomes. The compound is not a dietary supplement and is not intended for human consumption.
Cardarine is a common name for GW501516, a synthetic compound developed in the 1990s through research collaborations involving GlaxoSmithKline. It belongs to a class of molecules known as peroxisome proliferator-activated receptor delta agonists. Early studies explored its effects on lipid metabolism and energy expenditure in animal models. The compound was never approved as a human medicine, and clinical development was discontinued. In the years since, it has appeared in fitness and bodybuilding communities as a performance-enhancing substance. Regulatory agencies classify it as an unapproved drug.
Detection of GW501516 in biological samples generally relies on liquid chromatography coupled with tandem mass spectrometry. Urine is a common matrix in anti-doping analysis, while blood or plasma may be used in research settings. Sample preparation can involve enzymatic hydrolysis, protein precipitation, or solid-phase extraction before instrumental analysis. Because the compound undergoes metabolism, assays may target the parent molecule, one or more metabolites, or both. Detection windows are not fixed; they depend on factors such as dose, route, individual metabolism, and assay sensitivity. Reference standards are required for accurate identification and quantification.
Handling and quality assessment of cardarine reference material follow general laboratory practices for poorly characterized compounds. It typically appears as a white to off-white powder and is sparingly soluble in water but soluble in organic solvents such as dimethyl sulfoxide and ethanol. Storage recommendations usually specify a cool, dry, dark place, with long-term storage at low temperature and desiccation. Purity may be checked by high-performance liquid chromatography with ultraviolet detection, while identity is confirmed by mass spectrometry and nuclear magnetic resonance. No pharmacopeial monograph exists, so reported purity and stability depend on the supplier’s methods.
| Property | Value | Notes |
|---|---|---|
| CAS Registry Number | 317318-70-0 | Unique identifier for the compound. |
| Chemical class | PPARδ agonist | Synthetic ligand for peroxisome proliferator-activated receptor delta. |
| Appearance | White to off-white solid | Typical form of research-grade material. |
| Solubility | Soluble in DMSO and ethanol | Poorly soluble in water. |
| Typical storage | -20°C | Recommended for long-term storage of stock solutions. |
Anti-doping laboratories identify GW501516 and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is the usual matrix, and detection can occur after the parent compound has cleared from blood. The exact detection window depends on dose, formulation, individual metabolism, and assay sensitivity. Because the compound is prohibited at all times, athletes are subject to testing in and out of competition. Analytical methods continue to improve as new metabolites and designer analogs are characterized.
GW501516 acts as a ligand for PPAR delta, a nuclear receptor that regulates transcription of genes involved in fatty acid oxidation and energy use. Activation of this receptor in skeletal muscle shifts metabolism toward fat burning in animal models. The compound does not burn fat directly; it changes gene expression over hours to days. Researchers study it to understand metabolic flexibility and exercise adaptation. Effects observed in rodents are not automatically expected in humans.
Published human data are sparse and mostly come from early-phase trials. Those studies examined short-term changes in lipids, glucose, and exercise capacity, but they were not large enough to establish efficacy or long-term safety. Some animal experiments reported increased running endurance, yet such findings do not prove a performance benefit in people. Anti-doping laboratories detect GW501516 and its metabolites in urine or blood using liquid chromatography-tandem mass spectrometry. Detection windows depend on dose, sample type, and individual metabolism. The method is sensitive enough to identify trace residues in tested samples.
Laboratory handling focuses on identity, purity, and stability. Reference standards are typically stored cold and dry, protected from light, because solutions can degrade over time. Analytical checks may use high-performance liquid chromatography with ultraviolet detection or mass spectrometry. Impurities and related substances can be separated chromatographically and compared with a known standard. Because cardarine is not an approved drug, compendial monographs are absent, and laboratories often rely on in-house methods. Reported purity varies among unregulated products and should not be assumed from a label.
Cardarine is a common name for GW501516, a synthetic compound first described in the 1990s as a selective agonist of the peroxisome proliferator-activated receptor delta. It was studied in preclinical models for metabolic and cardiovascular conditions, but it has not been approved as a medicine in the United States, Europe, or other major jurisdictions. Retail products labeled as cardarine are generally research chemicals or supplements, not pharmaceutical formulations. Because human safety and efficacy data remain limited, regulatory agencies treat it as an unapproved substance rather than a therapeutic product.
Sporting authorities added GW501516 to prohibited lists after it appeared in athlete samples and online markets. The World Anti-Doping Agency classifies it as a hormone and metabolic modulator, and its use can lead to an anti-doping rule violation. Some early laboratory work suggested effects on fatty acid oxidation and endurance-related metabolism in animals, but those findings do not establish safe or effective use in people. Reports of adverse events in humans are scarce and often anecdotal, which complicates risk assessment.
UPS also has a separate product called "Ground Saver" which uses the UPS Ground network to deliver packages weighing under 10 pounds to the nearest UPS Package Center, which transfers them to the USPS DDU for "final mile" delivery. More recently, the continued growth of online shopping, combined with increasing awareness of the role of transportation (including package delivery) on the environment, has contributed to the rise of emerging competition from niche carriers or rebranded incumbents. For instance, the US Postal Service claims "greener delivery" of parcels on the assumption that USPS letter carriers deliver to each US address, six days a week anyway, and therefore offer the industry's lowest fuel consumption per delivery. Other carriers, like ParcelPool.com, which specializes in residential package delivery to APO/FPO addresses, Hawaii, Alaska, Puerto Rico, and other US Territories, arose in response to increased demand from catalog retailers and online e-tailers for low-cost residential delivery services closely matching service standards normally associated with more expensive expedited parcel delivery. In 2019, UPS sued in an attempt to force USPS to raise their prices, but was rejected by the Supreme Court.
=== Antimicrobial agents === Rhizopus cultures responsible for the fermentation of tempeh from soybean produce natural, heat-stable antimicrobial agents against spoilage and disease-causing microorganisms, extending the shelf life of the fermented product through microbial antagonism. The mold is capable of inhibiting the growth of other fungi such as Aspergillus flavus and Aspergillus parasiticus by interfering with the accumulation of aflatoxin (especially aflatoxin B1), the mycotoxin of greatest concern. R. oligosporus has also been reported to produce four to five antibacterial substances during fermentation process. It produces phenolic compounds against pathogenic bacteria such as Helicobacter pylori and an antibacterial protein has been identified with activities against Bacillus species (especially against Bacillus subtilis and Bacillus cereus), Staphylococcus aureus, and Streptococcus cremoris.
Medical applications of radio frequency (RF) energy, in the form of electromagnetic waves (radio waves) or electrical currents, have existed for over 125 years, and now include diathermy, hyperthermy treatment of cancer, electrosurgery scalpels used to cut and cauterize in operations, and radiofrequency ablation. Magnetic resonance imaging (MRI) uses radio frequency fields to generate images of the human body.
=== Emergency gas supply === The professional diver is usually required to carry an emergency gas supply with sufficient gas to reach a place of safety in an emergency involving failure of the surface supplied gas. For surface oriented dives, this may require sufficient gas for planned decompression.
Sources: en.wikipedia.org
== Further reading == Aziz, Nusrate; Asadullah, M Niaz (2017). "Military spending, armed conflict and economic growth in developing countries in the post–Cold War era" (PDF). Journal of Economic Studies. 44 (1): 47–68. doi:10.1108/JES-01-2015-0021. Bartel, Fritz (2022). The Triumph of Broken Promises: The End of the Cold War and the Rise of Neoliberalism. Harvard University Press. ISBN 9780674976788. Henriksen, Thomas H. (2017). Cycles in US Foreign Policy Since the Cold War. Palgrave Macmillan. Jones, Bruce D.; Stedman, Stephen John (2017). "Civil Wars & the Post–Cold War International Order". Dædalus. 146 (4): 33–44. Menon, Rajan; Rumer, Eugene B., eds. (2015). Conflict in Ukraine: The Unwinding of the Post–Cold War Order. MIT Press. Peterson, James W. (2017). Russian-American relations in the post–Cold War world. Oxford UP. Sakwa, Richard (2017). Russia against the Rest: The Post–Cold War Crisis of World Order. Cambridge UP. p. 362. Wood, Luke B. (2017). "The politics of identity and security in post–Cold War Western and Central Europe". European Politics and Society. 18 (4): 552–556. doi:10.1080/23745118.2017.1376444.
=== Industrial processes === Argon is used in some high-temperature industrial processes where ordinarily non-reactive substances become reactive. For example, an argon atmosphere is used in graphite electric furnaces to prevent the graphite from burning. For some of these processes, the presence of nitrogen or oxygen gases might cause defects within the material. Argon is used in some types of arc welding such as gas metal arc welding and gas tungsten arc welding, as well as in the processing of titanium and other reactive elements. An argon atmosphere is also used for growing crystals of silicon and germanium.
Alongside dame school, Thomas also took private lessons from Gwen James, an elocution teacher who had studied at drama school in London, winning several major prizes. She also taught "Dramatic Art" and "Voice Production", and would often help cast members of the Swansea Little Theatre (see below) with the parts they were playing. Thomas's parents' storytelling and dramatic talents, as well as their theatre-going interests, could also have contributed to the young Thomas's interest in performance. In October 1925, Thomas enrolled at Swansea Grammar School for boys, in Mount Pleasant, where his father taught English. There are several accounts by his teachers and fellow pupils of Thomas's time at grammar school. In June 1928, Thomas won the school's mile race, held at St. Helen's Ground; he carried a newspaper photograph of his victory with him until his death. As a pupil he shied away from the school curriculum, preferring his own choice of reading, drama activities and contributing to the school's magazine of which he became editor. Examples of plagiarised poems he published under his own name in the magazine, and in some cases more widely, have been noted by his biographers. Subsequent research has revealed the extent and virtuosity of Thomas's plagiarism, including having a poem published in the nationally read Boy's Own Paper that had been published in the same magazine 15 years before. During his final school years he began writing his distinctively original poetry in notebooks; the first poem, dated 27 April (1930), is entitled "Osiris, come to Isis".
The fund's devolution to union territories by the union government has no criteria where all the revenue goes to the union government. Some union territories are provided more funds, while others are given less, arbitrarily by the union government. As union territories are directly ruled by the union government, some union territories get more funds from the union government than entitled on per capita and backwardness basis when compared to states. After the introduction of GST, UT-GST is applicable in union territories that do not have a legislative assembly. UT-GST is levied at par with the applicable state GST in the rest of the country which would eliminate the previous lower taxation in the union territories.
=== Structural material === Graphene's strength, stiffness and lightness suggested it for use with carbon fiber. Graphene has been used as a reinforcing agent to improve the mechanical properties of biodegradable polymeric nanocomposites for engineering bone tissue. It has also been used as a strengthening agent in concrete.
Sources: en.wikipedia.org
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
== Research directions == Recently, a large body of scientific research deals with the background of autoimmune disease, the cause of many rheumatic disorders. Also, the field of osteoimmunology has emerged to further examine the interactions between the immune system, joints, and bones. Epidemiological studies and medication trials are also being conducted. The Rheumatology Research Foundation is the largest private funding source of rheumatology research and training in the United States.
=== Etymology === Obesity is from the Latin obesitas, which means "stout, fat, or plump". Ēsus is the past participle of edere (to eat), with ob (over) added to it. The Oxford English Dictionary documents its first usage in 1611 by Randle Cotgrave.
==== 1914–1916: Initial Zionist–British Government discussions ==== In July 1914, war broke out in Europe between the Triple Entente (Britain, France, and the Russian Empire) and the Central Powers (Germany, Austria-Hungary, and, later that year, the Ottoman Empire). The British Cabinet first discussed Palestine at a meeting on 9 November 1914, four days after Britain's declaration of war on the Ottoman Empire, of which the Mutasarrifate of Jerusalem – often referred to as Palestine – was a component. At the meeting David Lloyd George, then Chancellor of the Exchequer, "referred to the ultimate destiny of Palestine". The Chancellor, whose law firm Lloyd George, Roberts and Co had been engaged a decade before by the Zionist Federation of Great Britain and Ireland to work on the Uganda Scheme, was to become prime minister by the time of the declaration, and was ultimately responsible for it.
Sources: en.wikipedia.org
Cardarine is a common name for GW501516, a synthetic PPARδ agonist developed for research. It has not been approved as a medication in any country. It is classified as an unapproved drug and a prohibited substance in sport.
No. Cardarine is not an anabolic steroid; it belongs to a different chemical class that targets PPARδ. Steroids act primarily through androgen receptors, while cardarine acts through a nuclear receptor involved in metabolism.
Some rodent studies reported increased endurance and changes in fat metabolism after cardarine exposure. Long-term studies in animals also raised concerns about cancer in certain tissues. Human trial data are limited, so these findings cannot be directly translated to people.
Cardarine targets PPARδ, a nuclear receptor involved in lipid and energy metabolism. It does not bind the androgen receptor in the way SARMs do.